PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma105g00590.1
Common NameZOSMA_105G00590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 287aa    MW: 33237.7 Da    PI: 9.5259
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma105g00590.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.17.2e-314595151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+++fss+g+lyeys+
  Zosma105g00590.1 45 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALVVFSSRGRLYEYSN 95
                      79***********************************************95 PP

2K-box112.34.9e-371142106100
             K-box   6 gks..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       +++  +e+ +++++qqe+akL+ +i+ Lq+ +Rhl+G++L+sLs+keL+qLe++L++++++iRskK+ell+++ie +qk+e elq++n++Lr+
  Zosma105g00590.1 114 NSRiiVETDTQQYYQQEAAKLRHQIQILQNANRHLMGDSLSSLSVKELKQLENRLDRGISRIRSKKHELLFAEIEFMQKREVELQNDNMYLRT 206
                       33356889999********************************************************************************** PP

             K-box  97 klee 100
                       k++e
  Zosma105g00590.1 207 KIAE 210
                       *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.813797IPR002100Transcription factor, MADS-box
SMARTSM004328.1E-423796IPR002100Transcription factor, MADS-box
CDDcd002655.21E-4538114No hitNo description
SuperFamilySSF554551.83E-3238110IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003993IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-323959IPR002100Transcription factor, MADS-box
PfamPF003193.2E-264693IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-325974IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-327495IPR002100Transcription factor, MADS-box
PfamPF014866.8E-28120208IPR002487Transcription factor, K-box
PROSITE profilePS5129716.004124214IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MMEVKYFAIL TLKHQQQARQ TYEVEGRGDI CRGERRMGRG KIEIKRIENT TNRQVTFCKR  60
RNGLLKKAYE LSVLCDAEIA LVVFSSRGRL YEYSNNSIKS TIERYKKAHA DSSNSRIIVE  120
TDTQQYYQQE AAKLRHQIQI LQNANRHLMG DSLSSLSVKE LKQLENRLDR GISRIRSKKH  180
ELLFAEIEFM QKREVELQND NMYLRTKIAE NERAQQVSMV HAGPDFESLQ AFDCRNYFPV  240
NMLEAAASHY PTAAASIHHH QDQTALHLGY DTKSNQVADR ITNFHV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-2137118185Myocyte-specific enhancer factor 2B
1tqe_Q5e-2137118185Myocyte-specific enhancer factor 2B
1tqe_R5e-2137118185Myocyte-specific enhancer factor 2B
1tqe_S5e-2137118185Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781978.11e-141PREDICTED: MADS-box transcription factor 3-like
RefseqXP_008781979.11e-141PREDICTED: MADS-box transcription factor 3-like
SwissprotQ8RU311e-105MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLA0A0K9Q4Y30.0A0A0K9Q4Y3_Z
STRINGGSMUA_Achr7P23690_0011e-135(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-103MIKC_MADS family protein